PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015894480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 590aa    MW: 66782.5 Da    PI: 5.7897
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015894480.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like772.4e-24200253155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  XP_015894480.1 200 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 253
                     68*******************.9*******************************8 PP

2Response_reg814e-27201281109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+p+ +++l+++l+k  y ev+++  +++al ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ G
  XP_015894480.1  20 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLARDALSLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHG 112
                     89*********************.***************999999**********************6644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ ++el++
  XP_015894480.1 113 ACDYLLKPIRMKELRN 128
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.5E-4417142No hitNo description
SuperFamilySSF521722.99E-3517141IPR011006CheY-like superfamily
SMARTSM004486.9E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.14319134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.4E-2420129IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.34E-3021134No hitNo description
Gene3DG3DSA:1.10.10.607.9E-28198258IPR009057Homeodomain-like
SuperFamilySSF466894.3E-17198257IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-21200253IPR006447Myb domain, plants
PfamPF002491.8E-7202252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MENGFSSPRN NDTFPAGLRV LVVDDDPTWL KILEKMLKKC SYEVTTCGLA RDALSLLRER  60
KDGYDIVISD VNMPDMDGFK LLEHVGLEMD LPVIMMSVDG ETSRVMKGVQ HGACDYLLKP  120
IRMKELRNIW QHVFRKKIHE IRDMESHESI DAVQMMRNGT DHSDDVQFLS MEDLTSVKKR  180
KDIENKHDDK DFSDTSSTKK ARVVWSVDLH QKFVKAVNQI GFDKVGPKKI LDLMNVPWLT  240
RENVASHLQK YRLYLSRLQK EKENDLKSSF VAMKHNDPKD PQGSFGLQNL MNTHQNDVVN  300
GGYKFSVNNV LVQNVDPTNH ESESIVSEPT TEPKRASASR LPDPLKTKNS QMVFNHSFAP  360
LESEVNLTAF GSTIPTNYSW SEVPDIQFKQ EHKPLIQPEN GFSKLPVLDP PPHIHVDQLQ  420
SIPSISSKPT TIERGITGPI KSKPQNIEYG SNQVNCVSST VSTIDSFQIR PDMANHQPLE  480
PIYTNSSSMK TQIFNLSCLT DLESTQRTQT LGNGSPYVSF DDELPVLFQN DCYGMNLGLH  540
NVEFSEYNAA GLINEVPSHL CDSLRIGYEY PCDPTEYSVI DQGLFIHSMT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-17196258163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015894480.10.0PREDICTED: two-component response regulator ARR11
TrEMBLW9RKG50.0W9RKG5_9R
STRINGVIT_01s0010g02230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-127response regulator 11